The String function allows one to extract sequences of an entry to be extracted easily.
xi | : | { posint, 0} |
yi | : | { posint, 0} |
Returns:
This function returns a list of sequences. For each xi,
DB[string][xi..DB[TotChars] is
returned. For each element yi of a Sequence structure,
the contents of the <SEQ>, </SEQ> tags for the entry found
at Sequence(yi) are returned as a string.
> String(1, 100, 1000, 20000, 70000); # first form of String [DBNAME>SH2 Database</DBNAME><DBRELEASE>1.0</DBRELE ..(76824) .. G</SEQ></E>, ROSINE-PROTEIN KINASE ABL-1 (EC 2.7.1.112) (F RAGME ..(76725).. G</SEQ></E>, E ABL2 (EC 2.7.1.112) (TYROSIN E KINASE ARG).</DE>< ..(75825).. G</SEQ></E>, VSTSQLLQFALHVAE GMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGL ..(56825).. G</SEQ></E>, MAN</ID><AC>P07947;</AC><DE>PROTO-ONCOGENE TYROSIN ..(6825).. G</SEQ></E>] > seq_offsets := Sequence(Entry(1, 2, 78)); # get the sequence offsets seq_offsets := Sequences(367,1338,76197) > the_seqs := String(seq_offsets); # get the sequences the_seqs := [NNEWCEARLYSTRKNDASNQRRLGEIGWVPSNFIAPYNSLDKYTWYHG KI ..(557).. DVVPLAEKNVR, MGQQVGRVGEAPGLQQPQPRGIRGSSAARPSGRRR DPAGRTTETGFNIFT ..(1182).. CVQEISDVVQR, MPDPAAHLPFFYGSISRAEAE EHLKLAGMADGLFLLRQCLRSLGGYVLSL ..(618).. QCEQVAEAACG] > mixed := String(60000, 70000, Sequence(2533)); mixed := [YVAEYKSLDAEEWFFGQVKRVDAEKQLMMPFNNLGSFLIRDSDTTPGDFS. .(16825).. G</SEQ></E>, MAN</ID><AC>P07947;</AC><DE>PROTO-ONC OGENE TYROSIN ..(6825).. G</SEQ></E>, MLEICLKLVGCKSKKGLSSSSSC YLEEALQRPVASDFEPQGLSEAARWNS ..(1130).. SVKEISDIVQR]